Lineage for d5bywa_ (5byw A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095432Species Clostridium thermocellum [TaxId:203119] [269902] (4 PDB entries)
  8. 2095437Domain d5bywa_: 5byw A: [318362]
    automated match to d3amda_

Details for d5bywa_

PDB Entry: 5byw (more details), 2.6 Å

PDB Description: crystal structure of engineered trifunctional ctcel5e
PDB Compounds: (A:) endoglucanase h

SCOPe Domain Sequences for d5bywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bywa_ c.1.8.0 (A:) automated matches {Clostridium thermocellum [TaxId: 203119]}
avdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnhtm
rtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqiaer
fknksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntlvn
ikipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedmdtvvrvfdfvksws
drnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndmaiyn
rdtrtfdteilnalfnpgt

SCOPe Domain Coordinates for d5bywa_:

Click to download the PDB-style file with coordinates for d5bywa_.
(The format of our PDB-style files is described here.)

Timeline for d5bywa_: