| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (6 species) |
| Species Human (Homo sapiens) [TaxId:9606] [187038] (23 PDB entries) |
| Domain d5b2ie_: 5b2i E: [318347] Other proteins in same PDB: d5b2ib_, d5b2ic_, d5b2id_, d5b2if_, d5b2ig_, d5b2ih_ automated match to d1eqzg_ protein/DNA complex; complexed with mn |
PDB Entry: 5b2i (more details), 3 Å
SCOPe Domain Sequences for d5b2ie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b2ie_ a.22.1.1 (E:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
eaylvglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d5b2ie_: