Lineage for d5b2ie_ (5b2i E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698296Protein Histone H3 [47122] (6 species)
  7. 2698397Species Human (Homo sapiens) [TaxId:9606] [187038] (23 PDB entries)
  8. 2698442Domain d5b2ie_: 5b2i E: [318347]
    Other proteins in same PDB: d5b2ib_, d5b2ic_, d5b2id_, d5b2if_, d5b2ig_, d5b2ih_
    automated match to d1eqzg_
    protein/DNA complex; complexed with mn

Details for d5b2ie_

PDB Entry: 5b2i (more details), 3 Å

PDB Description: human nucleosome containing cpg unmethylated dna
PDB Compounds: (E:) Histone H3.1

SCOPe Domain Sequences for d5b2ie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b2ie_ a.22.1.1 (E:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
eaylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d5b2ie_:

Click to download the PDB-style file with coordinates for d5b2ie_.
(The format of our PDB-style files is described here.)

Timeline for d5b2ie_: