| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Burkholderia cenocepacia [TaxId:216591] [193149] (10 PDB entries) |
| Domain d5jydg_: 5jyd G: [318337] automated match to d3r3sa_ complexed with edo, iod, mg, na, nad |
PDB Entry: 5jyd (more details), 1.65 Å
SCOPe Domain Sequences for d5jydg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jydg_ c.2.1.0 (G:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
ltnpvdlypkppfphqvqappglasrmqprpdhgeqsyrgrgrlvgrktlvtggdsgigr
aaaiafaregadvaigylpveesdarevvaliraagrqavalpgdirdetfcqrlvaraa
ealggldilvnnaarqqaldsigemttehfdatvktnlygmfwitkaaiphlppgasiin
ttsvqavrasanlldyattkagiiaftrslakqlgprgirvnavapgpywtplqssggqp
petvvnyaagspygrpgqpaeiaplyvalaasetsyangqvwgadgglgif
Timeline for d5jydg_: