SCOPe 2.08: Domain d5jvdb1: 5jvd B:2-245

Lineage for d5jvdb1 (5jvd B:2-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d5jvdb1: 5jvd B:2-245 [318333]
   Other proteins in same PDB: d5jvda2, d5jvdb2, d5jvdc2, d5jvdd2, d5jvde_, d5jvdf1, d5jvdf2, d5jvdf3
   automated match to d4drxb1
   complexed with 6nl, acp, ca, gdp, gol, gtp, mes, mg

Details for d5jvdb1

PDB Entry: 5jvd, 2.39 Å

PDB Description: tubulin-tub092 complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5jvdb1:

Sequence; same for both SEQRES and ATOM records:

>d5jvdb1 c.32.1.1 (B:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d5jvdb1:

• d5jvdb1 first appeared in SCOPe 2.06
  
• d5jvdb1 appears in SCOPe 2.07