![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces peucetius [TaxId:1950] [318207] (1 PDB entry) |
![]() | Domain d5it1c_: 5it1 C: [318323] automated match to d4ubsa_ complexed with 2oh, hem |
PDB Entry: 5it1 (more details), 2.1 Å
SCOPe Domain Sequences for d5it1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5it1c_ a.104.1.0 (C:) automated matches {Streptomyces peucetius [TaxId: 1950]} tagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrdpsfs vgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqrivde hldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaaatea agmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahdttac miglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeiggvria kgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqivfgt lfrrfptlrlakpveelrfrndmvfygvhelpvtw
Timeline for d5it1c_: