Lineage for d5it1c_ (5it1 C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. Protein automated matches [190847] (97 species)
    not a true protein
  7. Species Streptomyces peucetius [TaxId:1950] [318207] (1 PDB entry)
  8. Domain d5it1c_: 5it1 C: [318323]
    automated match to d4ubsa_
    complexed with 2oh, hem

Details for d5it1c_

PDB Entry: 5it1 (more details), 2.1 Å

PDB Description: streptomyces peucetius cyp105p2 complex with biphenyl compound
PDB Compounds: (C:) putative cytochrome P450

SCOPe Domain Sequences for d5it1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5it1c_ a.104.1.0 (C:) automated matches {Streptomyces peucetius [TaxId: 1950]}
tagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrdpsfs
vgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqrivde
hldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaaatea
agmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahdttac
miglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeiggvria
kgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqivfgt
lfrrfptlrlakpveelrfrndmvfygvhelpvtw

SCOPe Domain Coordinates for d5it1c_ are not available.

Timeline for d5it1c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5it1a_, d5it1b_, d5it1d_