Lineage for d4uhia_ (4uhi A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007940Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2007941Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2008652Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2008653Protein automated matches [190847] (64 species)
    not a true protein
  7. 2008729Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2008807Domain d4uhia_: 4uhi A: [318322]
    automated match to d4cohb_
    complexed with hem, vfv

Details for d4uhia_

PDB Entry: 4uhi (more details), 2.04 Å

PDB Description: human sterol 14-alpha demethylase (cyp51) in complex with vfv in c121 space group
PDB Compounds: (A:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d4uhia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhia_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns
knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk
eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl
lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde
vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl
nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld
fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp
tvnyttmihtpenpvirykrrs

SCOPe Domain Coordinates for d4uhia_:

Click to download the PDB-style file with coordinates for d4uhia_.
(The format of our PDB-style files is described here.)

Timeline for d4uhia_: