SCOPe 2.06: Domain d5i1kl1: 5i1k L:1-107

Lineage for d5i1kl1 (5i1k L:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d5i1kl1: 5i1k L:1-107 [318317]
   Other proteins in same PDB: d5i1kl2
   automated match to d1dn0a1
   complexed with gol, nhe, so4

Details for d5i1kl1

PDB Entry: 5i1k, 1.65 Å

PDB Description: crystal structure of human germline antibody ighv5-51/igkv3-20

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d5i1kl1:

Sequence; same for both SEQRES and ATOM records:

>d5i1kl1 b.1.1.1 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspltfgqgtkvei

Timeline for d5i1kl1:

• d5i1kl1 is new in SCOPe 2.06-stable
  
• d5i1kl1 appears in SCOPe 2.07
  
• d5i1kl1 appears in the current release, SCOPe 2.08