![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
![]() | Domain d5i1jl1: 5i1j L:1-106 [318313] Other proteins in same PDB: d5i1jh_, d5i1jl2 automated match to d1dn0a1 complexed with gol |
PDB Entry: 5i1j (more details), 2.5 Å
SCOPe Domain Sequences for d5i1jl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i1jl1 b.1.1.1 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa rfsgsgsgtdftltisslepedfavyycqqrsnwpltfgqgtkvei
Timeline for d5i1jl1: