Lineage for d5l3vb2 (5l3v B:88-293)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869314Protein automated matches [190304] (16 species)
    not a true protein
  7. 2869398Species Sulfolobus solfataricus [TaxId:2287] [318298] (1 PDB entry)
  8. 2869400Domain d5l3vb2: 5l3v B:88-293 [318299]
    Other proteins in same PDB: d5l3va1, d5l3vb1
    automated match to d1qzxa3
    complexed with gdp, so4

Details for d5l3vb2

PDB Entry: 5l3v (more details), 2.3 Å

PDB Description: structure of the crenarchaeal srp54 gtpase bound to gdp
PDB Compounds: (B:) Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d5l3vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l3vb2 c.37.1.10 (B:88-293) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
pnvnptklpfiimlvgvqgsgktttagklayfykkrgykvglvaadvyrpaaydqllqlg
nqigvqvygepnnqnpieiakkgvdifvknkmdiiivdtagrhgygeetklleemkemyd
vlkpddvilvidasigqkaydlasrfhqaspigsviitkmdgtakgggalsavvatgati
kfigtgekideletfnakrfvsrilg

SCOPe Domain Coordinates for d5l3vb2:

Click to download the PDB-style file with coordinates for d5l3vb2.
(The format of our PDB-style files is described here.)

Timeline for d5l3vb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5l3vb1