Lineage for d5l3vb1 (5l3v B:2-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700314Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 2700370Family a.24.13.0: automated matches [229049] (1 protein)
    not a true family
  6. 2700371Protein automated matches [229050] (7 species)
    not a true protein
  7. 2700401Species Sulfolobus solfataricus [TaxId:2287] [318296] (1 PDB entry)
  8. 2700403Domain d5l3vb1: 5l3v B:2-87 [318297]
    Other proteins in same PDB: d5l3va2, d5l3vb2
    automated match to d1qzxa1
    complexed with gdp, so4

Details for d5l3vb1

PDB Entry: 5l3v (more details), 2.3 Å

PDB Description: structure of the crenarchaeal srp54 gtpase bound to gdp
PDB Compounds: (B:) Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d5l3vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l3vb1 a.24.13.0 (B:2-87) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
lenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekpp
svlerkewfisivydelsklfggdke

SCOPe Domain Coordinates for d5l3vb1:

Click to download the PDB-style file with coordinates for d5l3vb1.
(The format of our PDB-style files is described here.)

Timeline for d5l3vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5l3vb2