![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) ![]() |
![]() | Family a.24.13.0: automated matches [229049] (1 protein) not a true family |
![]() | Protein automated matches [229050] (7 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [318296] (1 PDB entry) |
![]() | Domain d5l3vb1: 5l3v B:2-87 [318297] Other proteins in same PDB: d5l3va2, d5l3vb2 automated match to d1qzxa1 complexed with gdp, so4 |
PDB Entry: 5l3v (more details), 2.3 Å
SCOPe Domain Sequences for d5l3vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l3vb1 a.24.13.0 (B:2-87) automated matches {Sulfolobus solfataricus [TaxId: 2287]} lenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekpp svlerkewfisivydelsklfggdke
Timeline for d5l3vb1: