Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d5i1ll2: 5i1l L:113-220 [318293] Other proteins in same PDB: d5i1la1, d5i1lb_, d5i1lh1, d5i1lh2, d5i1ll1 automated match to d1dn0a2 complexed with gol |
PDB Entry: 5i1l (more details), 1.95 Å
SCOPe Domain Sequences for d5i1ll2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i1ll2 b.1.1.2 (L:113-220) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d5i1ll2: