| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
| Protein automated matches [226935] (30 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [318235] (1 PDB entry) |
| Domain d5jsca2: 5jsc A:240-397 [318291] Other proteins in same PDB: d5jsca1, d5jscb1, d5jscc1, d5jscd1 automated match to d5idua2 complexed with cl, edo, fad, so4 |
PDB Entry: 5jsc (more details), 1.5 Å
SCOPe Domain Sequences for d5jsca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jsca2 a.29.3.0 (A:240-397) automated matches {Burkholderia xenovorans [TaxId: 266265]}
gegfklamrtldifrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqltqaklaqm
altidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlyggmgvqsgta
vemlyreiralriyegatevqqlivgrdllkahaaata
Timeline for d5jsca2: