SCOP 1.67: Domain d1qs0a_: 1qs0 A:

Lineage for d1qs0a_ (1qs0 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (3 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein 2-oxoisovalerate dehydrogenase (E1B), PP module [88769] (1 species)
   chain A is alpha-subunit and chain B is beta-subunit

7. Species Pseudomonas putida [TaxId:303] [88770] (1 PDB entry)

8. Domain d1qs0a_: 1qs0 A: [31829]
   Other proteins in same PDB: d1qs0b1, d1qs0b2
   complexed with hri, mg, tdp

Details for d1qs0a_

PDB Entry: 1qs0, 2.4 Å

PDB Description: crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b)

SCOP Domain Sequences for d1qs0a_:

Sequence; same for both SEQRES and ATOM records:

>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida}
neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel

Timeline for d1qs0a_:

• d1qs0a_ first appeared (with stable ids) in SCOP 1.55, called d1qs0a1
  
• d1qs0a_ appears in SCOP 1.65
  
• d1qs0a_ appears in SCOP 1.69
  
• d1qs0a_ appears in the current release, SCOPe 2.08