![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) ![]() both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules |
![]() | Family c.36.1.3: Branched-chain alpha-keto acid dehydrogenase THDP-binding domains [52531] (3 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
![]() | Protein 2-oxoisovalerate dehydrogenase (E1B), PP and Pyr modules [52534] (1 species) chain A is alpha-subunit and chain B is beta-subunit |
![]() | Species Pseudomonas putida [TaxId:303] [52535] (1 PDB entry) |
![]() | Domain d1qs0a_: 1qs0 A: [31829] Other proteins in same PDB: d1qs0b2 complexed with hri, mg, tdp |
PDB Entry: 1qs0 (more details), 2.4 Å
SCOP Domain Sequences for d1qs0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qs0a_ c.36.1.3 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP and Pyr modules {Pseudomonas putida} neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel
Timeline for d1qs0a_: