SCOPe 2.07: Domain d4zr2b_: 4zr2 B:

Lineage for d4zr2b_ (4zr2 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)

8. Domain d4zr2b_: 4zr2 B: [318287]
   automated match to d4zcbb_
   complexed with act, ret; mutant

Details for d4zr2b_

PDB Entry: 4zr2, 1.8 Å

PDB Description: crystal structure of the domain-swapped dimer k40l:q108k:y60w mutant of human cellular retinol binding protein ii

PDB Compounds: (B:) Retinol-binding protein 2

SCOPe Domain Sequences for d4zr2b_:

Sequence; same for both SEQRES and ATOM records:

>d4zr2b_ b.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfktkttstfrnw
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

Timeline for d4zr2b_:

• d4zr2b_ first appeared in SCOPe 2.06
  
• d4zr2b_ appears in the current release, SCOPe 2.08