Lineage for d5l3sc1 (5l3s C:16-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700314Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 2700370Family a.24.13.0: automated matches [229049] (1 protein)
    not a true family
  6. 2700371Protein automated matches [229050] (7 species)
    not a true protein
  7. 2700404Species Sulfolobus solfataricus [TaxId:273057] [318283] (1 PDB entry)
  8. 2700406Domain d5l3sc1: 5l3s C:16-87 [318284]
    Other proteins in same PDB: d5l3sa2, d5l3sc2, d5l3se2, d5l3sg2
    automated match to d1qzxa1
    complexed with g, gnp, gol, mg, so4

Details for d5l3sc1

PDB Entry: 5l3s (more details), 1.9 Å

PDB Description: structure of the gtpase heterodimer of crenarchaeal srp54 and ftsy
PDB Compounds: (C:) Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d5l3sc1:

Sequence, based on SEQRES records: (download)

>d5l3sc1 a.24.13.0 (C:16-87) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
stpyekavdefikdlqkslissdvnvklvfsltakikerlnkekppsvlerkewfisivy
delsklfggdke

Sequence, based on observed residues (ATOM records): (download)

>d5l3sc1 a.24.13.0 (C:16-87) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
stpyekavdefikdlqkslissdvnvklvfsltakikerlnkekkewfisivydelsklf
ggdke

SCOPe Domain Coordinates for d5l3sc1:

Click to download the PDB-style file with coordinates for d5l3sc1.
(The format of our PDB-style files is described here.)

Timeline for d5l3sc1: