![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module automatically mapped to Pfam PF02779 |
![]() | Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88743] (23 PDB entries) Uniprot P21953 52-392 |
![]() | Domain d1dtwb1: 1dtw B:17-204 [31828] Other proteins in same PDB: d1dtwa_, d1dtwb2 complexed with k, mg, tdp |
PDB Entry: 1dtw (more details), 2.7 Å
SCOPe Domain Sequences for d1dtwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dtwb1 c.36.1.7 (B:17-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} qtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkdrvfntplce qgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfncgsltirspw gcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpciffepkilyra aaeevpie
Timeline for d1dtwb1: