Lineage for d4z86b1 (4z86 B:3-197)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142123Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2142137Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2142138Protein automated matches [193326] (10 species)
    not a true protein
  7. 2142199Species Vibrio cholerae [TaxId:243277] [311867] (10 PDB entries)
  8. 2142205Domain d4z86b1: 4z86 B:3-197 [318276]
    Other proteins in same PDB: d4z86a2, d4z86b2
    automated match to d4y2zb_
    mutant

Details for d4z86b1

PDB Entry: 4z86 (more details), 1.63 Å

PDB Description: crystal structure of peptidyl-trna hydrolase mutant -n118d from vibrio cholerae at 1.63a resolution.
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4z86b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z86b1 c.56.3.0 (B:3-197) automated matches {Vibrio cholerae [TaxId: 243277]}
sqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsqel
rvlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghdglkd
tisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqexldaavdesvrcleilmkd
gltkaqnrlhtfkae

SCOPe Domain Coordinates for d4z86b1:

Click to download the PDB-style file with coordinates for d4z86b1.
(The format of our PDB-style files is described here.)

Timeline for d4z86b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4z86b2