Lineage for d5jyda_ (5jyd A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107207Species Burkholderia cenocepacia [TaxId:216591] [193149] (10 PDB entries)
  8. 2107231Domain d5jyda_: 5jyd A: [318266]
    automated match to d3r3sa_
    complexed with edo, iod, mg, na, nad

Details for d5jyda_

PDB Entry: 5jyd (more details), 1.65 Å

PDB Description: crystal structure of a putative short chain dehydrogenase from burkholderia cenocepacia
PDB Compounds: (A:) Short chain dehydrogenase

SCOPe Domain Sequences for d5jyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jyda_ c.2.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
ltnpvdlypkppfphqvqappglasrmqprpdhgeqsyrgrgrlvgrktlvtggdsgigr
aaaiafaregadvaigylpveesdarevvaliraagrqavalpgdirdetfcqrlvaraa
ealggldilvnnaarqqaldsigemttehfdatvktnlygmfwitkaaiphlppgasiin
ttsvqavrasanlldyattkagiiaftrslakqlgprgirvnavapgpywtplqssggqp
petvvnyaagspygrpgqpaeiaplyvalaasetsyangqvwgadgglgif

SCOPe Domain Coordinates for d5jyda_:

Click to download the PDB-style file with coordinates for d5jyda_.
(The format of our PDB-style files is described here.)

Timeline for d5jyda_: