Lineage for d5l6wc_ (5l6w C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969863Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2969876Protein Cofilin (actin depolymerizing factor, ADF) [55763] (4 species)
  7. 2969885Species Human (Homo sapiens), non-muscle isoform [TaxId:9606] [111104] (3 PDB entries)
    Uniprot P23528
  8. 2969886Domain d5l6wc_: 5l6w C: [318263]
    automated match to d1q8xa_
    complexed with ags

Details for d5l6wc_

PDB Entry: 5l6w (more details), 2.53 Å

PDB Description: structure of the limk1-atpgammas-cfl1 complex
PDB Compounds: (C:) cofilin-1

SCOPe Domain Sequences for d5l6wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l6wc_ d.109.1.2 (C:) Cofilin (actin depolymerizing factor, ADF) {Human (Homo sapiens), non-muscle isoform [TaxId: 9606]}
acgvavsdgvikvfndmkvrksstpeevkkrkkavlfclsedkkniileegkeilvgdvg
qtvddpyatfvkmlpdkdcryalydatyetkeskkedlvfifwapesaplkskmiyassk
daikkkltgikhelqancyeevkdrctlaeklggsavislegkpl

SCOPe Domain Coordinates for d5l6wc_:

Click to download the PDB-style file with coordinates for d5l6wc_.
(The format of our PDB-style files is described here.)

Timeline for d5l6wc_: