Lineage for d1ay0b1 (1ay0 B:3-337)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179051Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 179052Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 179098Family c.36.1.2: TK-like [52528] (2 proteins)
  6. 179105Protein Transketolase, TK [52529] (1 species)
  7. 179106Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (7 PDB entries)
  8. 179133Domain d1ay0b1: 1ay0 B:3-337 [31825]
    Other proteins in same PDB: d1ay0a3, d1ay0b3

Details for d1ay0b1

PDB Entry: 1ay0 (more details), 2.6 Å

PDB Description: identification of catalytically important residues in yeast transketolase

SCOP Domain Sequences for d1ay0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ay0b1 c.36.1.2 (B:3-337) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
likmtttigygslhagshsvagaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
kpgveannkwnklfseyqkkfpelgaelarrlsgq

SCOP Domain Coordinates for d1ay0b1:

Click to download the PDB-style file with coordinates for d1ay0b1.
(The format of our PDB-style files is described here.)

Timeline for d1ay0b1: