Lineage for d5icca1 (5icc A:3-104)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695147Species Thalictrum flavum [TaxId:150095] [318179] (8 PDB entries)
  8. 2695156Domain d5icca1: 5icc A:3-104 [318248]
    Other proteins in same PDB: d5icca2, d5icca3
    automated match to d1fp2a1
    complexed with edo, k, na, sah

Details for d5icca1

PDB Entry: 5icc (more details), 1.9 Å

PDB Description: crystal structure of (s)-norcoclaurine 6-o-methyltransferase with s- adenosyl-l-homocysteine
PDB Compounds: (A:) (S)-norcoclaurine 6-O-methyltransferase

SCOPe Domain Sequences for d5icca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5icca1 a.4.5.0 (A:3-104) automated matches {Thalictrum flavum [TaxId: 150095]}
minkenlssqaklwnfiygfadslvlksavqldlaniihnhgspmtlselslhlpsqpvn
qdalyrvlrylvhmklftkssidgelryglappakflvkgwd

SCOPe Domain Coordinates for d5icca1:

Click to download the PDB-style file with coordinates for d5icca1.
(The format of our PDB-style files is described here.)

Timeline for d5icca1: