Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (48 PDB entries) |
Domain d5jvdc1: 5jvd C:2-245 [318243] Other proteins in same PDB: d5jvda2, d5jvdb2, d5jvdc2, d5jvdd2, d5jvde_, d5jvdf1, d5jvdf2, d5jvdf3 automated match to d4ihja1 complexed with 6nl, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5jvd (more details), 2.39 Å
SCOPe Domain Sequences for d5jvdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jvdc1 c.32.1.1 (C:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr irkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssitas lrfd
Timeline for d5jvdc1: