Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.6: TK-like Pyr module [88735] (2 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
Protein Transketolase (TK), Pyr module [88736] (4 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88737] (7 PDB entries) |
Domain d1ay0a2: 1ay0 A:338-534 [31824] Other proteins in same PDB: d1ay0a1, d1ay0a3, d1ay0b1, d1ay0b3 complexed with ca, tpp |
PDB Entry: 1ay0 (more details), 2.6 Å
SCOPe Domain Sequences for d1ay0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ay0a2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles khtpsiialsrqnlpql
Timeline for d1ay0a2: