Lineage for d5jscd2 (5jsc D:240-398)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708557Species Burkholderia xenovorans [TaxId:266265] [318235] (1 PDB entry)
  8. 2708561Domain d5jscd2: 5jsc D:240-398 [318236]
    Other proteins in same PDB: d5jsca1, d5jscb1, d5jscc1, d5jscd1
    automated match to d5idua2
    complexed with cl, edo, fad, so4

Details for d5jscd2

PDB Entry: 5jsc (more details), 1.5 Å

PDB Description: crystal structure of a putative acyl-coa dehydrogenase from burkholderia xenovorans
PDB Compounds: (D:) putative acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5jscd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jscd2 a.29.3.0 (D:240-398) automated matches {Burkholderia xenovorans [TaxId: 266265]}
gegfklamrtldifrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqltqaklaqm
altidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlyggmgvqsgta
vemlyreiralriyegatevqqlivgrdllkahaaatag

SCOPe Domain Coordinates for d5jscd2:

Click to download the PDB-style file with coordinates for d5jscd2.
(The format of our PDB-style files is described here.)

Timeline for d5jscd2: