Lineage for d5jscd1 (5jsc D:6-239)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015708Species Burkholderia xenovorans [TaxId:266265] [318233] (1 PDB entry)
  8. 3015712Domain d5jscd1: 5jsc D:6-239 [318234]
    Other proteins in same PDB: d5jsca2, d5jscb2, d5jscc2, d5jscd2
    automated match to d5idua1
    complexed with cl, edo, fad, so4

Details for d5jscd1

PDB Entry: 5jsc (more details), 1.5 Å

PDB Description: crystal structure of a putative acyl-coa dehydrogenase from burkholderia xenovorans
PDB Compounds: (D:) putative acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5jscd1:

Sequence, based on SEQRES records: (download)

>d5jscd1 e.6.1.0 (D:6-239) automated matches {Burkholderia xenovorans [TaxId: 266265]}
eldlhsalawpffeprhrelaagieawcranlahedhedvdatcrrlvrelgaagwlkyg
vggvaygghgdtidtravcllretlakhsgladfalamqglgsgaislggtheqktrylp
rvangtaiaafalsepeagsdvaamtlsaredgdayvldgdktwisnggiadfyvvfart
geapgargisafvvdadtpgleiaeridviaphplarlhfagarvprsqmlgap

Sequence, based on observed residues (ATOM records): (download)

>d5jscd1 e.6.1.0 (D:6-239) automated matches {Burkholderia xenovorans [TaxId: 266265]}
eldlhsalawpffeprhrelaagieawcranladvdatcrrlvrelgaagwlkygvggva
ygghgdtidtravcllretlakhsgladfalamqglgsgaislggtheqktrylprvang
taiaafalsepeagsdvaamtlsaredgdayvldgdktwisnggiadfyvvfartgeapg
argisafvvdadtpgleiaeridviaphplarlhfagarvprsqmlgap

SCOPe Domain Coordinates for d5jscd1:

Click to download the PDB-style file with coordinates for d5jscd1.
(The format of our PDB-style files is described here.)

Timeline for d5jscd1: