Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily) complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354 |
Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) automatically mapped to Pfam PF02511 |
Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins) |
Protein Thy1 homologue [69798] (1 species) |
Species Thermotoga maritima [TaxId:2336] [69799] (29 PDB entries) TM0449 |
Domain d5iota_: 5iot A: [318225] Other proteins in same PDB: d5iotb2 automated match to d3g4cc_ complexed with fad, ump |
PDB Entry: 5iot (more details), 2 Å
SCOPe Domain Sequences for d5iota_:
Sequence, based on SEQRES records: (download)
>d5iota_ d.207.1.1 (A:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]} mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlaadshaq weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv
>d5iota_ d.207.1.1 (A:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]} mkidildkgfvelvdvmgndlsavraarvsfdeerdrhlieylmkhghetpfehivftfh vkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervtekisei vdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlaadshaqweiqq yalaiarifkekcpwtfeaflkyaykgdilkevqv
Timeline for d5iota_:
View in 3D Domains from other chains: (mouse over for more information) d5iotb1, d5iotb2, d5iotc_, d5iotd_ |