SCOPe 2.06: Domain d5hlva1: 5hlv A:2-89

Lineage for d5hlva1 (5hlv A:2-89)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (42 PDB entries)

8. Domain d5hlva1: 5hlv A:2-89 [318220]
   Other proteins in same PDB: d5hlva2, d5hlvb2, d5hlvd2, d5hlve2, d5hlvf2, d5hlvg2, d5hlvh2
   automated match to d2y5ie_
   complexed with act, ca, cl, zn

Details for d5hlva1

PDB Entry: 5hlv, 2.2 Å

PDB Description: crystal structure of calcium and zinc-bound human s100a8 in space group p212121

PDB Compounds: (A:) Protein S100-A8

SCOPe Domain Sequences for d5hlva1:

Sequence; same for both SEQRES and ATOM records:

>d5hlva1 a.39.1.2 (A:2-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldin
tdgavnfqeflilvikmgvaahkkshee

Timeline for d5hlva1:

• d5hlva1 is new in SCOPe 2.06-stable
  
• d5hlva1 appears in SCOPe 2.07
  
• d5hlva1 appears in the current release, SCOPe 2.08