Lineage for d1ngsb2 (1ngs B:338-534)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121562Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 121563Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 121609Family c.36.1.2: Transketolase, TK [52528] (1 protein)
  6. 121610Protein Transketolase, TK [52529] (1 species)
  7. 121611Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (7 PDB entries)
  8. 121627Domain d1ngsb2: 1ngs B:338-534 [31822]
    Other proteins in same PDB: d1ngsa3, d1ngsb3

Details for d1ngsb2

PDB Entry: 1ngs (more details), 2.4 Å

PDB Description: complex of transketolase with thiamin diphosphate, ca2+ and acceptor substrate erythrose-4-phosphate

SCOP Domain Sequences for d1ngsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngsb2 c.36.1.2 (B:338-534) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf
qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa
lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles
khtpsiialsrqnlpql

SCOP Domain Coordinates for d1ngsb2:

Click to download the PDB-style file with coordinates for d1ngsb2.
(The format of our PDB-style files is described here.)

Timeline for d1ngsb2: