Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) |
Family c.36.1.2: Transketolase, TK [52528] (1 protein) |
Protein Transketolase, TK [52529] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (6 PDB entries) |
Domain d1ngsb2: 1ngs B:338-534 [31822] Other proteins in same PDB: d1ngsa3, d1ngsb3 |
PDB Entry: 1ngs (more details), 2.4 Å
SCOP Domain Sequences for d1ngsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngsb2 c.36.1.2 (B:338-534) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)} lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles khtpsiialsrqnlpql
Timeline for d1ngsb2: