![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily) complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354 |
![]() | Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) ![]() automatically mapped to Pfam PF02511 |
![]() | Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins) |
![]() | Protein Thy1 homologue [69798] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [69799] (29 PDB entries) TM0449 |
![]() | Domain d5iosb_: 5ios B: [318219] Other proteins in same PDB: d5iosa2 automated match to d3g4cc_ complexed with fad, ump |
PDB Entry: 5ios (more details), 1.9 Å
SCOPe Domain Sequences for d5iosb_:
Sequence, based on SEQRES records: (download)
>d5iosb_ d.207.1.1 (B:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]} mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi vftfhvkapifvarqwfrhriasynelsgaysklsyefyipsperlegykttippervte kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq weiqqyalaiarifkekcpwtfeaflkyaykgdilkev
>d5iosb_ d.207.1.1 (B:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]} mkidildkgfvelvdvmgndlsavraarvsfdeerdrhlieylmkhghetpfehivftfh vkapifvarqwfrhriasynelsgaysklsyefyipsperlegykttippervtekisei vdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaqweiqq yalaiarifkekcpwtfeaflkyaykgdilkev
Timeline for d5iosb_:
![]() Domains from other chains: (mouse over for more information) d5iosa1, d5iosa2, d5iosc_, d5iosd_ |