Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Streptomyces peucetius [TaxId:1950] [318207] (1 PDB entry) |
Domain d5it1b_: 5it1 B: [318208] automated match to d4ubsa_ complexed with 2oh, hem |
PDB Entry: 5it1 (more details), 2.1 Å
SCOPe Domain Sequences for d5it1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5it1b_ a.104.1.0 (B:) automated matches {Streptomyces peucetius [TaxId: 1950]} tagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrdpsfs vgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqrivde hldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaaatea agmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahdttac miglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeiggvria kgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqivfgt lfrrfptlrlakpveelrfrndmvfygvhelpvtw
Timeline for d5it1b_: