Lineage for d5it1b_ (5it1 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (72 species)
    not a true protein
  7. 2332204Species Streptomyces peucetius [TaxId:1950] [318207] (1 PDB entry)
  8. 2332206Domain d5it1b_: 5it1 B: [318208]
    automated match to d4ubsa_
    complexed with 2oh, hem

Details for d5it1b_

PDB Entry: 5it1 (more details), 2.1 Å

PDB Description: streptomyces peucetius cyp105p2 complex with biphenyl compound
PDB Compounds: (B:) putative cytochrome P450

SCOPe Domain Sequences for d5it1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5it1b_ a.104.1.0 (B:) automated matches {Streptomyces peucetius [TaxId: 1950]}
tagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrdpsfs
vgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqrivde
hldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaaatea
agmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahdttac
miglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeiggvria
kgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqivfgt
lfrrfptlrlakpveelrfrndmvfygvhelpvtw

SCOPe Domain Coordinates for d5it1b_:

Click to download the PDB-style file with coordinates for d5it1b_.
(The format of our PDB-style files is described here.)

Timeline for d5it1b_: