Lineage for d5azsa_ (5azs A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576245Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. 2576246Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. 2576275Family f.5.1.0: automated matches [227266] (1 protein)
    not a true family
  6. 2576276Protein automated matches [227059] (5 species)
    not a true protein
  7. 2576284Species Pseudomonas aeruginosa [TaxId:208964] [318062] (5 PDB entries)
  8. 2576295Domain d5azsa_: 5azs A: [318205]
    automated match to d1wp1a_

Details for d5azsa_

PDB Entry: 5azs (more details), 3.1 Å

PDB Description: crystal structure of a membrane protein from pseudomonas aeruginosa
PDB Compounds: (A:) Outer membrane protein OprJ

SCOPe Domain Sequences for d5azsa_:

Sequence, based on SEQRES records: (download)

>d5azsa_ f.5.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
csmaptyerpaapvadswsgaaaqrqgaaidtldwksfivdaelrrlvdmaldnnrslrq
tlldieaaraqyriqradrvpglnaaatgnrqrqpadlsagnrsevassyqvglalpeye
ldlfgrvksltdaalqqylaseeaaraarialvaevsqaylsydgalrrlaltrqtlvsr
eysfalidqrraagaataldyqealglveqaraeqernlrqkqqafnalvlllgsddaaq
aiprspgqrpkllqdiapgtpselierrpdilaaehrlrarnadigaaraaffprisltg
sfgtssaemsglfdggsrswsflptltlpifdggrnranlslaearkdsavaayegtiqt
afrevadalaasdtlrreekalralanssnealklakaryesgvdnhlryldaqrssfln
eiafidgstqrqialvdlfralg

Sequence, based on observed residues (ATOM records): (download)

>d5azsa_ f.5.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
csmaptyerpaapvadswsldwksfivdaelrrlvdmaldnnrslrqtlldieaaraqyr
iqradrvpglnaaatgnrqrqpadlsagnrsevassyqvglalpeyeldlfgrvksltda
alqqylaseeaaraarialvaevsqaylsydgalrrlaltrqtlvsreysfalidqrraa
gaataldyqealglveqaraeqernlrqkqqafnalvlllgsddaaqaiprspgqrpkll
qdiapgtpselierrpdilaaehrlrarnadigaaraaffprisltgsfgtssaemsglf
dggsrswsflptltlpifdggrnranlslaearkdsavaayegtiqtafrevadalaasd
tlrreekalralanssnealklakaryesgvdnhlryldaqrssflneiafidgstqrqi
alvdlfralg

SCOPe Domain Coordinates for d5azsa_:

Click to download the PDB-style file with coordinates for d5azsa_.
(The format of our PDB-style files is described here.)

Timeline for d5azsa_: