| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
| Domain d5i16a1: 5i16 A:1-106 [318200] Other proteins in same PDB: d5i16a2, d5i16b_, d5i16h_, d5i16l2 automated match to d1dn0a1 complexed with gol, mes |
PDB Entry: 5i16 (more details), 1.9 Å
SCOPe Domain Sequences for d5i16a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i16a1 b.1.1.1 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqrsnwpltfgqgtkvei
Timeline for d5i16a1:
View in 3DDomains from other chains: (mouse over for more information) d5i16b_, d5i16h_, d5i16l1, d5i16l2 |