Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) |
Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
Protein Uracil-DNA glycosylase [52143] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [52144] (16 PDB entries) |
Domain d5ayra1: 5ayr A:85-304 [318197] Other proteins in same PDB: d5ayra2, d5ayra3, d5ayrc2, d5ayrc3 automated match to d1emha_ protein/DNA complex; complexed with mg |
PDB Entry: 5ayr (more details), 2.4 Å
SCOPe Domain Sequences for d5ayra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ayra1 c.18.1.1 (A:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq dpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl qtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
Timeline for d5ayra1: