Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (81 species) not a true protein |
Species Thalictrum flavum [TaxId:150095] [318181] (8 PDB entries) |
Domain d5icea2: 5ice A:105-350 [318195] Other proteins in same PDB: d5icea1, d5icea3 automated match to d1fp2a2 complexed with 2h4, edo, k, sah |
PDB Entry: 5ice (more details), 1.6 Å
SCOPe Domain Sequences for d5icea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5icea2 c.66.1.0 (A:105-350) automated matches {Thalictrum flavum [TaxId: 150095]} kcmlgailtitdkdfmapwhylkegilndgststafekalgtniwdymaehpeknqlfne gmandtrlimsalvkecssmfdgittivdvgggtgtavrniakafphikctvydlphvia dspgyteinsiqgdmfkyipnadaimmkcilhdwddkecieilkrckdavprdggkviii diildvksehpytkmrltldldmmlntggkerteeewkklihdagykgykithisavqsv ieaypy
Timeline for d5icea2: