Lineage for d1ngsa1 (1ngs A:3-337)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22854Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 22855Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 22895Family c.36.1.2: Transketolase, TK [52528] (1 protein)
  6. 22896Protein Transketolase, TK [52529] (1 species)
  7. 22897Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (6 PDB entries)
  8. 22906Domain d1ngsa1: 1ngs A:3-337 [31819]
    Other proteins in same PDB: d1ngsa3, d1ngsb3

Details for d1ngsa1

PDB Entry: 1ngs (more details), 2.4 Å

PDB Description: complex of transketolase with thiamin diphosphate, ca2+ and acceptor substrate erythrose-4-phosphate

SCOP Domain Sequences for d1ngsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngsa1 c.36.1.2 (A:3-337) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
kpgveannkwnklfseyqkkfpelgaelarrlsgq

SCOP Domain Coordinates for d1ngsa1:

Click to download the PDB-style file with coordinates for d1ngsa1.
(The format of our PDB-style files is described here.)

Timeline for d1ngsa1: