Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Thalictrum flavum [TaxId:150095] [318179] (8 PDB entries) |
Domain d5icga1: 5icg A:8-104 [318180] Other proteins in same PDB: d5icga2 automated match to d1fp2a1 complexed with k |
PDB Entry: 5icg (more details), 2.6 Å
SCOPe Domain Sequences for d5icga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5icga1 a.4.5.0 (A:8-104) automated matches {Thalictrum flavum [TaxId: 150095]} nlssqaklwnfiygfadslvlksavqldlaniihnhgspmtlselslhlpsqpvnqdaly rvlrylvhmklftkssidgelryglappakflvkgwd
Timeline for d5icga1: