SCOPe 2.07: Domain d5icga1: 5icg A:8-104

Lineage for d5icga1 (5icg A:8-104)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Thalictrum flavum [TaxId:150095] [318179] (8 PDB entries)

8. Domain d5icga1: 5icg A:8-104 [318180]
   Other proteins in same PDB: d5icga2
   automated match to d1fp2a1
   complexed with k

Details for d5icga1

PDB Entry: 5icg, 2.6 Å

PDB Description: crystal structure of apo (s)-norcoclaurine 6-o-methyltransferase

PDB Compounds: (A:) (S)-norcoclaurine 6-O-methyltransferase

SCOPe Domain Sequences for d5icga1:

Sequence; same for both SEQRES and ATOM records:

>d5icga1 a.4.5.0 (A:8-104) automated matches {Thalictrum flavum [TaxId: 150095]}
nlssqaklwnfiygfadslvlksavqldlaniihnhgspmtlselslhlpsqpvnqdaly
rvlrylvhmklftkssidgelryglappakflvkgwd

Timeline for d5icga1:

• d5icga1 first appeared in SCOPe 2.06
  
• d5icga1 appears in the current release, SCOPe 2.08