Lineage for d1tkab2 (1tka B:338-534)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179051Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 179052Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 179098Family c.36.1.2: TK-like [52528] (2 proteins)
  6. 179105Protein Transketolase, TK [52529] (1 species)
  7. 179106Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (7 PDB entries)
  8. 179126Domain d1tkab2: 1tka B:338-534 [31818]
    Other proteins in same PDB: d1tkaa3, d1tkab3

Details for d1tkab2

PDB Entry: 1tka (more details), 2.7 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkab2 c.36.1.2 (B:338-534) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf
qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa
lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles
khtpsiialsrqnlpql

SCOP Domain Coordinates for d1tkab2:

Click to download the PDB-style file with coordinates for d1tkab2.
(The format of our PDB-style files is described here.)

Timeline for d1tkab2: