Lineage for d5er4x_ (5er4 X:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323269Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2323270Protein Calcyclin (S100) [47479] (17 species)
  7. 2323271Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (26 PDB entries)
  8. 2323288Domain d5er4x_: 5er4 X: [318174]
    automated match to d1cfpa_
    complexed with 5rl, ca

Details for d5er4x_

PDB Entry: 5er4 (more details), 1.81 Å

PDB Description: crystal structure of calcium-loaded s100b bound to sc0025
PDB Compounds: (X:) Protein S100-B

SCOPe Domain Sequences for d5er4x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5er4x_ a.39.1.2 (X:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffe

SCOPe Domain Coordinates for d5er4x_:

Click to download the PDB-style file with coordinates for d5er4x_.
(The format of our PDB-style files is described here.)

Timeline for d5er4x_: