| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
| Protein Calcyclin (S100) [47479] (17 species) |
| Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (8 PDB entries) Migration inhibitory factor-related protein 8 |
| Domain d5hlob1: 5hlo B:2-93 [318170] Other proteins in same PDB: d5hloa2, d5hlob2, d5hloc2, d5hlod2 automated match to d2y5ie_ complexed with act, ca, cac, cl, zn |
PDB Entry: 5hlo (more details), 2.1 Å
SCOPe Domain Sequences for d5hlob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hlob1 a.39.1.2 (B:2-93) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}
ltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldin
tdgavnfqeflilvikmgvaahkksheeshke
Timeline for d5hlob1: