Lineage for d5aysb1 (5ays B:17-244)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2437896Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2437897Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2437898Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 protein domains)
  6. 2437959Protein automated matches [190540] (4 species)
    not a true protein
  7. 2437962Species Herpes simplex virus type 1 [TaxId:10299] [226744] (2 PDB entries)
  8. 2437966Domain d5aysb1: 5ays B:17-244 [318165]
    Other proteins in same PDB: d5aysa2, d5aysb2
    automated match to d4l5na_
    protein/DNA complex

Details for d5aysb1

PDB Entry: 5ays (more details), 2.09 Å

PDB Description: crystal structure of saugi/hsv udg complex
PDB Compounds: (B:) uracil-DNA glycosylase

SCOPe Domain Sequences for d5aysb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aysb1 c.18.1.1 (B:17-244) automated matches {Herpes simplex virus type 1 [TaxId: 10299]}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

SCOPe Domain Coordinates for d5aysb1:

Click to download the PDB-style file with coordinates for d5aysb1.
(The format of our PDB-style files is described here.)

Timeline for d5aysb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5aysb2