![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
![]() | Protein Calcyclin (S100) [47479] (17 species) |
![]() | Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (8 PDB entries) Migration inhibitory factor-related protein 8 |
![]() | Domain d5hlve1: 5hlv E:2-88 [318159] Other proteins in same PDB: d5hlva2, d5hlvb2, d5hlvd2, d5hlve2, d5hlvf2, d5hlvg2, d5hlvh2 automated match to d2y5ie_ complexed with act, ca, cl, zn |
PDB Entry: 5hlv (more details), 2.2 Å
SCOPe Domain Sequences for d5hlve1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hlve1 a.39.1.2 (E:2-88) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} ltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldin tdgavnfqeflilvikmgvaahkkshe
Timeline for d5hlve1: