| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein automated matches [190085] (59 species) not a true protein |
| Species Daffodil (Narcissus pseudonarcissus) [TaxId:39639] [318114] (2 PDB entries) |
| Domain d5fffb_: 5fff B: [318156] automated match to d1xq1a_ complexed with 5xc, nap |
PDB Entry: 5fff (more details), 1.5 Å
SCOPe Domain Sequences for d5fffb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fffb_ c.2.1.2 (B:) automated matches {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]}
mslekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlky
dvtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavn
lesafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewa
kdnirtnsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsas
yitgqvicvdggrting
Timeline for d5fffb_: