Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Daffodil (Narcissus pseudonarcissus) [TaxId:39639] [318152] (1 PDB entry) |
Domain d5feua_: 5feu A: [318153] automated match to d3gdfa_ complexed with nap |
PDB Entry: 5feu (more details), 1.73 Å
SCOPe Domain Sequences for d5feua_:
Sequence, based on SEQRES records: (download)
>d5feua_ c.2.1.0 (A:) automated matches {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]} slekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlkyd vtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavnl esafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewak dnirtnsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsasy itgqvicvdggrting
>d5feua_ c.2.1.0 (A:) automated matches {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]} slekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlkyd vtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavnl esafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewak dnirtnsiapgairtpgtdrevsrvpfgrigepeevaslaaflcmpsasyitgqvicvdg grting
Timeline for d5feua_: