Lineage for d5feua_ (5feu A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (247 species)
    not a true protein
  7. 2431099Species Daffodil (Narcissus pseudonarcissus) [TaxId:39639] [318152] (1 PDB entry)
  8. 2431100Domain d5feua_: 5feu A: [318153]
    automated match to d3gdfa_
    complexed with nap

Details for d5feua_

PDB Entry: 5feu (more details), 1.73 Å

PDB Description: noroxomaritidine/norcraugsodine reductase in complex with nadp+
PDB Compounds: (A:) Noroxomaritidine/Norcraugsodine Reductase

SCOPe Domain Sequences for d5feua_:

Sequence, based on SEQRES records: (download)

>d5feua_ c.2.1.0 (A:) automated matches {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]}
slekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlkyd
vtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavnl
esafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewak
dnirtnsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsasy
itgqvicvdggrting

Sequence, based on observed residues (ATOM records): (download)

>d5feua_ c.2.1.0 (A:) automated matches {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]}
slekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlkyd
vtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavnl
esafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewak
dnirtnsiapgairtpgtdrevsrvpfgrigepeevaslaaflcmpsasyitgqvicvdg
grting

SCOPe Domain Coordinates for d5feua_:

Click to download the PDB-style file with coordinates for d5feua_.
(The format of our PDB-style files is described here.)

Timeline for d5feua_: