Lineage for d5hlvd1 (5hlv D:2-89)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710101Protein Calcyclin (S100) [47479] (17 species)
  7. 2710164Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (8 PDB entries)
    Migration inhibitory factor-related protein 8
  8. 2710193Domain d5hlvd1: 5hlv D:2-89 [318151]
    Other proteins in same PDB: d5hlva2, d5hlvb2, d5hlvd2, d5hlve2, d5hlvf2, d5hlvg2, d5hlvh2
    automated match to d2y5ie_
    complexed with act, ca, cl, zn

Details for d5hlvd1

PDB Entry: 5hlv (more details), 2.2 Å

PDB Description: crystal structure of calcium and zinc-bound human s100a8 in space group p212121
PDB Compounds: (D:) Protein S100-A8

SCOPe Domain Sequences for d5hlvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hlvd1 a.39.1.2 (D:2-89) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}
ltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldin
tdgavnfqeflilvikmgvaahkkshee

SCOPe Domain Coordinates for d5hlvd1:

Click to download the PDB-style file with coordinates for d5hlvd1.
(The format of our PDB-style files is described here.)

Timeline for d5hlvd1: