Lineage for d5btqb_ (5btq B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338543Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2338544Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2338545Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 protein domains)
    automatically mapped to Pfam PF01126
  6. 2338591Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2338592Species Human (Homo sapiens) [TaxId:9606] [48616] (25 PDB entries)
    Uniprot P09601
  8. 2338638Domain d5btqb_: 5btq B: [318150]
    automated match to d1ni6c_
    complexed with bla, so4

Details for d5btqb_

PDB Entry: 5btq (more details), 2.08 Å

PDB Description: crystal structure of human heme oxygenase 1 h25r with biliverdin bound
PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d5btqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5btqb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellthd

SCOPe Domain Coordinates for d5btqb_:

Click to download the PDB-style file with coordinates for d5btqb_.
(The format of our PDB-style files is described here.)

Timeline for d5btqb_: