Lineage for d5aysa1 (5ays A:17-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855022Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 2855084Protein automated matches [190540] (4 species)
    not a true protein
  7. 2855087Species Herpes simplex virus type 1 [TaxId:10299] [226744] (2 PDB entries)
  8. 2855090Domain d5aysa1: 5ays A:17-244 [318140]
    Other proteins in same PDB: d5aysa2, d5aysb2
    automated match to d4l5na_
    protein/DNA complex

Details for d5aysa1

PDB Entry: 5ays (more details), 2.09 Å

PDB Description: crystal structure of saugi/hsv udg complex
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d5aysa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aysa1 c.18.1.1 (A:17-244) automated matches {Herpes simplex virus type 1 [TaxId: 10299]}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

SCOPe Domain Coordinates for d5aysa1:

Click to download the PDB-style file with coordinates for d5aysa1.
(The format of our PDB-style files is described here.)

Timeline for d5aysa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5aysa2